General Information

  • ID:  hor002558
  • Uniprot ID:  A0A7M7GM99
  • Protein name:  Neuropeptide like precursor 1
  • Gene name:  LOC100577694
  • Organism:  Apis mellifera (Honeybee)
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  NVGSVAREHGLPY
  • Length:  13(300-312)
  • Propeptide:  MVEMAYIRKLTRTLPVLRFGEPHWEDISDLVCEMGLTGNHLVTLLLYVAVVNEIRLPLVTCQDEDSTQCMPKTAFLALLRHPEVSSSLAAYSRAARVTQDTKSRNDMAHLRALTEEGDDTEICVPGRVYLQLLKDPVVRGDLSAILNGRTQKVPDLLGRLIDDTDQMDAREYPFEYQKRSIATLAKNDDLPISLHDRMAENEDDEEKRAVISSSDHSIIRDYLPPNGRSEEQALRDFSMEKRNVGTLARDFALPP
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A7M7GM99-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002558_AF2.pdbhor002558_ESM.pdb

Physical Information

Mass: 161276 Formula: C61H95N19O19
Absent amino acids: CDFIKMQTW Common amino acids: GV
pI: 7.54 Basic residues: 2
Polar residues: 5 Hydrophobic residues: 4
Hydrophobicity: -40 Boman Index: -1988
Half-Life / Aliphatic Index: 1.4 hour Aliphatic Index: 82.31
Instability Index: 373.85 Extinction Coefficient cystines: 1490
Absorbance 280nm: 124.17

Literature

  • PubMed ID:  19576913
  • Title:  Mass Spectrometric Profiling of (Neuro)-Peptides in the Worker Honeybee, Apis Mellifera